CFHR1,CFHL,CFHL1
  • CFHR1,CFHL,CFHL1

Anti-CFHR1 Antibody 100ul

Ref: AN-HPA038922-100ul
Anti-CFHR1

Información del producto

Polyclonal Antibody against Human CFHR1, Gene description: complement factor H-related 1, Alternative Gene Names: CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, H36-1, H36-2, HFL1, HFL2, Validated applications: ICC, IHC, WB, Uniprot ID: Q03591, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CFHR1
Gene Description complement factor H-related 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA
Immunogen TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, H36-1, H36-2, HFL1, HFL2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q03591
HTS Code 3002150000
Gene ID 3078
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CFHR1 Antibody 100ul

Anti-CFHR1 Antibody 100ul