C12orf73
  • C12orf73

Anti-C12orf73 Antibody 100ul

Ref: AN-HPA038883-100ul
Anti-C12orf73

Información del producto

Polyclonal Antibody against Human C12orf73, Gene description: chromosome 12 open reading frame 73, Alternative Gene Names: DKFZp547P055, FLJ13975, Validated applications: ICC, IHC, Uniprot ID: Q69YU5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C12orf73
Gene Description chromosome 12 open reading frame 73
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
Immunogen AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp547P055, FLJ13975
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q69YU5
HTS Code 3002150000
Gene ID 728568
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C12orf73 Antibody 100ul

Anti-C12orf73 Antibody 100ul