DENND5B,MGC24039
  • DENND5B,MGC24039

Anti-DENND5B Antibody 100ul

Ref: AN-HPA038865-100ul
Anti-DENND5B

Información del producto

Polyclonal Antibody against Human DENND5B, Gene description: DENN/MADD domain containing 5B, Alternative Gene Names: MGC24039, Validated applications: ICC, IHC, Uniprot ID: Q6ZUT9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DENND5B
Gene Description DENN/MADD domain containing 5B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK
Immunogen FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC24039
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZUT9
HTS Code 3002150000
Gene ID 160518
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DENND5B Antibody 100ul

Anti-DENND5B Antibody 100ul