ZC3H12C,KIAA1726
  • ZC3H12C,KIAA1726

Anti-ZC3H12C Antibody 25ul

Ref: AN-HPA038836-25ul
Anti-ZC3H12C

Información del producto

Polyclonal Antibody against Human ZC3H12C, Gene description: zinc finger CCCH-type containing 12C, Alternative Gene Names: KIAA1726, MCPIP3, Validated applications: IHC, Uniprot ID: Q9C0D7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZC3H12C
Gene Description zinc finger CCCH-type containing 12C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKP
Immunogen PRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1726, MCPIP3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0D7
HTS Code 3002150000
Gene ID 85463
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZC3H12C Antibody 25ul

Anti-ZC3H12C Antibody 25ul