SLC39A8,BIGM103
  • SLC39A8,BIGM103

Anti-SLC39A8 Antibody 100ul

Ref: AN-HPA038832-100ul
Anti-SLC39A8

Información del producto

Polyclonal Antibody against Human SLC39A8, Gene description: solute carrier family 39 (zinc transporter), member 8, Alternative Gene Names: BIGM103, Validated applications: IHC, Uniprot ID: Q9C0K1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC39A8
Gene Description solute carrier family 39 (zinc transporter), member 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
Immunogen LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BIGM103
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0K1
HTS Code 3002150000
Gene ID 64116
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC39A8 Antibody 100ul

Anti-SLC39A8 Antibody 100ul