MID1IP1,FLJ10386
  • MID1IP1,FLJ10386

Anti-MID1IP1 Antibody 100ul

Ref: AN-HPA038816-100ul
Anti-MID1IP1

Información del producto

Polyclonal Antibody against Human MID1IP1, Gene description: MID1 interacting protein 1, Alternative Gene Names: FLJ10386, G12-like, MIG12, STRAIT11499, THRSPL, Validated applications: IHC, Uniprot ID: Q9NPA3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MID1IP1
Gene Description MID1 interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
Immunogen CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10386, G12-like, MIG12, STRAIT11499, THRSPL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPA3
HTS Code 3002150000
Gene ID 58526
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MID1IP1 Antibody 100ul

Anti-MID1IP1 Antibody 100ul