PSMD4,AF,AF-1,Rpn10
  • PSMD4,AF,AF-1,Rpn10

Anti-PSMD4 Antibody 100ul

Ref: AN-HPA038807-100ul
Anti-PSMD4

Información del producto

Polyclonal Antibody against Human PSMD4, Gene description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 4, Alternative Gene Names: AF, AF-1, Rpn10, S5A, Validated applications: ICC, IHC, WB, Uniprot ID: P55036, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSMD4
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Immunogen AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AF, AF-1, Rpn10, S5A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55036
HTS Code 3002150000
Gene ID 5710
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PSMD4 Antibody 100ul

Anti-PSMD4 Antibody 100ul