TRIM55,MURF-2,RNF29
  • TRIM55,MURF-2,RNF29

Anti-TRIM55 Antibody 25ul

Ref: AN-HPA038793-25ul
Anti-TRIM55

Información del producto

Polyclonal Antibody against Human TRIM55, Gene description: tripartite motif containing 55, Alternative Gene Names: MURF-2, RNF29, Validated applications: IHC, Uniprot ID: Q9BYV6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRIM55
Gene Description tripartite motif containing 55
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GLGQIGPPGSEDSNVRKAEVAAAAASERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE
Immunogen GLGQIGPPGSEDSNVRKAEVAAAAASERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MURF-2, RNF29
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYV6
HTS Code 3002150000
Gene ID 84675
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TRIM55 Antibody 25ul

Anti-TRIM55 Antibody 25ul