MARK2,EMK1,PAR-1
  • MARK2,EMK1,PAR-1

Anti-MARK2 Antibody 25ul

Ref: AN-HPA038790-25ul
Anti-MARK2

Información del producto

Polyclonal Antibody against Human MARK2, Gene description: MAP/microtubule affinity-regulating kinase 2, Alternative Gene Names: EMK1, PAR-1, PAR-1B, Par1b, Validated applications: IHC, Uniprot ID: Q7KZI7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MARK2
Gene Description MAP/microtubule affinity-regulating kinase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
Immunogen SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EMK1, PAR-1, PAR-1B, Par1b
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7KZI7
HTS Code 3002150000
Gene ID 2011
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MARK2 Antibody 25ul

Anti-MARK2 Antibody 25ul