TMEM164,FLJ22679
  • TMEM164,FLJ22679

Anti-TMEM164 Antibody 25ul

Ref: AN-HPA038784-25ul
Anti-TMEM164

Información del producto

Polyclonal Antibody against Human TMEM164, Gene description: transmembrane protein 164, Alternative Gene Names: FLJ22679, RP13-360B22.2, Validated applications: ICC, IHC, Uniprot ID: Q5U3C3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TMEM164
Gene Description transmembrane protein 164
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR
Immunogen MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22679, RP13-360B22.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5U3C3
HTS Code 3002150000
Gene ID 84187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMEM164 Antibody 25ul

Anti-TMEM164 Antibody 25ul