EYA4,CMD1J,DFNA10 Ver mas grande

Anti-EYA4 Antibody 25ul

AN-HPA038772-25ul

Producto nuevo

Anti-EYA4

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name EYA4
Gene Description EYA transcriptional coactivator and phosphatase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS
Immunogen QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CMD1J, DFNA10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95677
HTS Code 3002150000
Gene ID 2070
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación WB, IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human EYA4, Gene description: EYA transcriptional coactivator and phosphatase 4, Alternative Gene Names: CMD1J, DFNA10, Validated applications: IHC, WB, Uniprot ID: O95677, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image