HSPE1,CPN10,GROES
  • HSPE1,CPN10,GROES

Anti-HSPE1 Antibody 25ul

Ref: AN-HPA038755-25ul
Anti-HSPE1

Información del producto

Polyclonal Antibody against Human HSPE1, Gene description: heat shock 10kDa protein 1, Alternative Gene Names: CPN10, GROES, Validated applications: IHC, WB, Uniprot ID: P61604, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HSPE1
Gene Description heat shock 10kDa protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
Immunogen GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPN10, GROES
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61604
HTS Code 3002150000
Gene ID 3336
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HSPE1 Antibody 25ul

Anti-HSPE1 Antibody 25ul