THYN1,THY28
  • THYN1,THY28

Anti-THYN1 Antibody 25ul

Ref: AN-HPA038732-25ul
Anti-THYN1

Información del producto

Polyclonal Antibody against Human THYN1, Gene description: thymocyte nuclear protein 1, Alternative Gene Names: THY28, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P016, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name THYN1
Gene Description thymocyte nuclear protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence AFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL
Immunogen AFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names THY28
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P016
HTS Code 3002150000
Gene ID 29087
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-THYN1 Antibody 25ul

Anti-THYN1 Antibody 25ul