YARS2,CGI-04
  • YARS2,CGI-04

Anti-YARS2 Antibody 25ul

Ref: AN-HPA038721-25ul
Anti-YARS2

Información del producto

Polyclonal Antibody against Human YARS2, Gene description: tyrosyl-tRNA synthetase 2, mitochondrial, Alternative Gene Names: CGI-04, FLJ13995, mt-TyrRS, Validated applications: IHC, Uniprot ID: Q9Y2Z4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name YARS2
Gene Description tyrosyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TSTTGAKLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVHGREG
Immunogen TSTTGAKLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVHGREG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-04, FLJ13995, mt-TyrRS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2Z4
HTS Code 3002150000
Gene ID 51067
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-YARS2 Antibody 25ul

Anti-YARS2 Antibody 25ul