PTGES3,cPGES,p23
  • PTGES3,cPGES,p23

Anti-PTGES3 Antibody 100ul

Ref: AN-HPA038673-100ul
Anti-PTGES3

Información del producto

Polyclonal Antibody against Human PTGES3, Gene description: prostaglandin E synthase 3 (cytosolic), Alternative Gene Names: cPGES, p23, TEBP, Validated applications: ICC, IHC, WB, Uniprot ID: Q15185, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PTGES3
Gene Description prostaglandin E synthase 3 (cytosolic)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB, ICC
Sequence CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT
Immunogen CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cPGES, p23, TEBP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15185
HTS Code 3002150000
Gene ID 10728
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PTGES3 Antibody 100ul

Anti-PTGES3 Antibody 100ul