PCDHGA2
  • PCDHGA2

Anti-PCDHGA2 Antibody 100ul

Ref: AN-HPA038625-100ul
Anti-PCDHGA2

Información del producto

Polyclonal Antibody against Human PCDHGA2, Gene description: protocadherin gamma subfamily A, 2, Alternative Gene Names: PCDH-GAMMA-A2, Validated applications: ICC, Uniprot ID: Q9Y5H1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCDHGA2
Gene Description protocadherin gamma subfamily A, 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDI
Immunogen ADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PCDH-GAMMA-A2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5H1
HTS Code 3002150000
Gene ID 56113
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCDHGA2 Antibody 100ul

Anti-PCDHGA2 Antibody 100ul