C11orf70,MGC13040
  • C11orf70,MGC13040

Anti-C11orf70 Antibody 25ul

Ref: AN-HPA038585-25ul
Anti-C11orf70

Información del producto

Polyclonal Antibody against Human C11orf70, Gene description: chromosome 11 open reading frame 70, Alternative Gene Names: MGC13040, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BRQ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C11orf70
Gene Description chromosome 11 open reading frame 70
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS
Immunogen RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC13040
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRQ4
HTS Code 3002150000
Gene ID 85016
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C11orf70 Antibody 25ul

Anti-C11orf70 Antibody 25ul