WDR63,DIC3,FLJ30067
  • WDR63,DIC3,FLJ30067

Anti-WDR63 Antibody 25ul

Ref: AN-HPA038526-25ul
Anti-WDR63

Información del producto

Polyclonal Antibody against Human WDR63, Gene description: WD repeat domain 63, Alternative Gene Names: DIC3, FLJ30067, NYD-SP29, Validated applications: IHC, WB, Uniprot ID: Q8IWG1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDR63
Gene Description WD repeat domain 63
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence IVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLV
Immunogen IVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DIC3, FLJ30067, NYD-SP29
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWG1
HTS Code 3002150000
Gene ID 126820
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR63 Antibody 25ul

Anti-WDR63 Antibody 25ul