APBB1,Fe65,RIR
  • APBB1,Fe65,RIR

Anti-APBB1 Antibody 100ul

Ref: AN-HPA038521-100ul
Anti-APBB1

Información del producto

Polyclonal Antibody against Human APBB1, Gene description: amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65), Alternative Gene Names: Fe65, RIR, Validated applications: ICC, IHC, Uniprot ID: O00213, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name APBB1
Gene Description amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGI
Immunogen QEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Fe65, RIR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00213
HTS Code 3002150000
Gene ID 322
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-APBB1 Antibody 100ul

Anti-APBB1 Antibody 100ul