RDH16,RODH-4,SDR9C8
  • RDH16,RODH-4,SDR9C8

Anti-RDH16 Antibody 100ul

Ref: AN-HPA038518-100ul
Anti-RDH16

Información del producto

Polyclonal Antibody against Human RDH16, Gene description: retinol dehydrogenase 16 (all-trans), Alternative Gene Names: RODH-4, SDR9C8, Validated applications: IHC, WB, Uniprot ID: O75452, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RDH16
Gene Description retinol dehydrogenase 16 (all-trans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT
Immunogen GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RODH-4, SDR9C8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75452
HTS Code 3002150000
Gene ID 8608
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RDH16 Antibody 100ul

Anti-RDH16 Antibody 100ul