RTKN2,bA531F24.1
  • RTKN2,bA531F24.1

Anti-RTKN2 Antibody 100ul

Ref: AN-HPA038446-100ul
Anti-RTKN2

Información del producto

Polyclonal Antibody against Human RTKN2, Gene description: rhotekin 2, Alternative Gene Names: bA531F24.1, Em:AC024597.2, FLJ39352, PLEKHK1, Validated applications: IHC, WB, Uniprot ID: Q8IZC4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RTKN2
Gene Description rhotekin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence AQPACMAEDAFAGFLNQQQMVEGLISWRRLYCVLRGGKLYCFYSPEEIEAKVEPALVVPINKETRIRAMDKDAKKRIHNFSVINPVP
Immunogen AQPACMAEDAFAGFLNQQQMVEGLISWRRLYCVLRGGKLYCFYSPEEIEAKVEPALVVPINKETRIRAMDKDAKKRIHNFSVINPVP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA531F24.1, Em:AC024597.2, FLJ39352, PLEKHK1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZC4
HTS Code 3002150000
Gene ID 219790
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RTKN2 Antibody 100ul

Anti-RTKN2 Antibody 100ul