NSMCE4A,bA500G22.3
  • NSMCE4A,bA500G22.3

Anti-NSMCE4A Antibody 100ul

Ref: AN-HPA038412-100ul
Anti-NSMCE4A

Información del producto

Polyclonal Antibody against Human NSMCE4A, Gene description: NSE4 homolog A, SMC5-SMC6 complex component, Alternative Gene Names: bA500G22.3, C10orf86, FLJ20003, NSE4A, Validated applications: ICC, Uniprot ID: Q9NXX6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NSMCE4A
Gene Description NSE4 homolog A, SMC5-SMC6 complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQGIIALSYRDWEEIVKTFEISEPVITPSQRQQKPSA
Immunogen FHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQGIIALSYRDWEEIVKTFEISEPVITPSQRQQKPSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA500G22.3, C10orf86, FLJ20003, NSE4A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXX6
HTS Code 3002150000
Gene ID 54780
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NSMCE4A Antibody 100ul

Anti-NSMCE4A Antibody 100ul