MINDY3,C10orf97
  • MINDY3,C10orf97

Anti-MINDY3 Antibody 100ul

Ref: AN-HPA038406-100ul
Anti-MINDY3

Información del producto

Polyclonal Antibody against Human MINDY3, Gene description: MINDY lysine 48 deubiquitinase 3, Alternative Gene Names: C10orf97, CARP, DERP5, FAM188A, FLJ13397, my042, Validated applications: IHC, Uniprot ID: Q9H8M7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MINDY3
Gene Description MINDY lysine 48 deubiquitinase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVM
Immunogen VSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C10orf97, CARP, DERP5, FAM188A, FLJ13397, my042
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H8M7
HTS Code 3002150000
Gene ID 80013
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MINDY3 Antibody 100ul

Anti-MINDY3 Antibody 100ul