ARSI,FLJ16069,SPG66
  • ARSI,FLJ16069,SPG66

Anti-ARSI Antibody 25ul

Ref: AN-HPA038398-25ul
Anti-ARSI

Información del producto

Polyclonal Antibody against Human ARSI, Gene description: arylsulfatase family, member I, Alternative Gene Names: FLJ16069, SPG66, Validated applications: IHC, Uniprot ID: Q5FYB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARSI
Gene Description arylsulfatase family, member I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE
Immunogen SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ16069, SPG66
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5FYB1
HTS Code 3002150000
Gene ID 340075
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARSI Antibody 25ul

Anti-ARSI Antibody 25ul