WBP1L,C10orf26
  • WBP1L,C10orf26

Anti-WBP1L Antibody 100ul

Ref: AN-HPA038371-100ul
Anti-WBP1L

Información del producto

Polyclonal Antibody against Human WBP1L, Gene description: WW domain binding protein 1-like, Alternative Gene Names: C10orf26, FLJ20154, OPAL1, Validated applications: ICC, WB, Uniprot ID: Q9NX94, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WBP1L
Gene Description WW domain binding protein 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence DSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQ
Immunogen DSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C10orf26, FLJ20154, OPAL1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NX94
HTS Code 3002150000
Gene ID 54838
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WBP1L Antibody 100ul

Anti-WBP1L Antibody 100ul