BUD13,Cwc26,fSAP71
  • BUD13,Cwc26,fSAP71

Anti-BUD13 Antibody 25ul

Ref: AN-HPA038341-25ul
Anti-BUD13

Información del producto

Polyclonal Antibody against Human BUD13, Gene description: BUD13 homolog (S. cerevisiae), Alternative Gene Names: Cwc26, fSAP71, MGC13125, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BRD0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BUD13
Gene Description BUD13 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC, ICC
Sequence PGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETM
Immunogen PGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cwc26, fSAP71, MGC13125
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRD0
HTS Code 3002150000
Gene ID 84811
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BUD13 Antibody 25ul

Anti-BUD13 Antibody 25ul