WASHC3,CCDC53
  • WASHC3,CCDC53

Anti-WASHC3 Antibody 100ul

Ref: AN-HPA038339-100ul
Anti-WASHC3

Información del producto

Polyclonal Antibody against Human WASHC3, Gene description: WASH complex subunit 3, Alternative Gene Names: CCDC53, CGI-116, Validated applications: ICC, IHC, Uniprot ID: Q9Y3C0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WASHC3
Gene Description WASH complex subunit 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSES
Immunogen PLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCDC53, CGI-116
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3C0
HTS Code 3002150000
Gene ID 51019
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WASHC3 Antibody 100ul

Anti-WASHC3 Antibody 100ul