EIF3A,EIF3
  • EIF3A,EIF3

Anti-EIF3A Antibody 100ul

Ref: AN-HPA038315-100ul
Anti-EIF3A

Información del producto

Polyclonal Antibody against Human EIF3A, Gene description: eukaryotic translation initiation factor 3, subunit A, Alternative Gene Names: EIF3, eIF3-p170, eIF3-theta, eIF3a, EIF3S10, KIAA0139, TIF32, Validated applications: IHC, WB, Uniprot ID: Q14152, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EIF3A
Gene Description eukaryotic translation initiation factor 3, subunit A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG
Immunogen LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EIF3, eIF3-p170, eIF3-theta, eIF3a, EIF3S10, KIAA0139, TIF32
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14152
HTS Code 3002150000
Gene ID 8661
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EIF3A Antibody 100ul

Anti-EIF3A Antibody 100ul