BLNK,BASH,bca
  • BLNK,BASH,bca

Anti-BLNK Antibody 25ul

Ref: AN-HPA038310-25ul
Anti-BLNK

Información del producto

Polyclonal Antibody against Human BLNK, Gene description: B-cell linker, Alternative Gene Names: BASH, bca, BLNK-s, Ly57, SLP-65, SLP65, Validated applications: IHC, Uniprot ID: Q8WV28, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BLNK
Gene Description B-cell linker
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS
Immunogen HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BASH, bca, BLNK-s, Ly57, SLP-65, SLP65
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WV28
HTS Code 3002150000
Gene ID 29760
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BLNK Antibody 25ul

Anti-BLNK Antibody 25ul