TMEM165,GDT1,TMPT27
  • TMEM165,GDT1,TMPT27

Anti-TMEM165 Antibody 100ul

Ref: AN-HPA038299-100ul
Anti-TMEM165

Información del producto

Polyclonal Antibody against Human TMEM165, Gene description: transmembrane protein 165, Alternative Gene Names: GDT1, TMPT27, TPARL, Validated applications: ICC, IHC, Uniprot ID: Q9HC07, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM165
Gene Description transmembrane protein 165
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
Immunogen REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GDT1, TMPT27, TPARL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HC07
HTS Code 3002150000
Gene ID 55858
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMEM165 Antibody 100ul

Anti-TMEM165 Antibody 100ul