PRPF40A,FBP-11
  • PRPF40A,FBP-11

Anti-PRPF40A Antibody 100ul

Ref: AN-HPA038273-100ul
Anti-PRPF40A

Información del producto

Polyclonal Antibody against Human PRPF40A, Gene description: PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae), Alternative Gene Names: FBP-11, FBP11, FLAF1, FLJ20585, FNBP3, HIP10, HYPA, NY-REN-6, Prp40, Validated applications: ICC, IHC, WB, Uniprot ID: O75400, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PRPF40A
Gene Description PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP
Immunogen NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FBP-11, FBP11, FLAF1, FLJ20585, FNBP3, HIP10, HYPA, NY-REN-6, Prp40
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75400
HTS Code 3002150000
Gene ID 55660
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PRPF40A Antibody 100ul

Anti-PRPF40A Antibody 100ul