XPO6,FLJ22519
  • XPO6,FLJ22519

Anti-XPO6 Antibody 25ul

Ref: AN-HPA038246-25ul
Anti-XPO6

Información del producto

Polyclonal Antibody against Human XPO6, Gene description: exportin 6, Alternative Gene Names: FLJ22519, KIAA0370, RANBP20, Validated applications: ICC, IHC, Uniprot ID: Q96QU8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name XPO6
Gene Description exportin 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKK
Immunogen RPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22519, KIAA0370, RANBP20
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96QU8
HTS Code 3002150000
Gene ID 23214
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-XPO6 Antibody 25ul

Anti-XPO6 Antibody 25ul