RBM43,C2orf38
  • RBM43,C2orf38

Anti-RBM43 Antibody 25ul

Ref: AN-HPA038204-25ul
Anti-RBM43

Información del producto

Polyclonal Antibody against Human RBM43, Gene description: RNA binding motif protein 43, Alternative Gene Names: C2orf38, FLJ45645, Validated applications: IHC, Uniprot ID: Q6ZSC3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM43
Gene Description RNA binding motif protein 43
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RTLVPETARSGEMLVLDTDVFLYLKHKCGSYESTLKKFHILSQEKVDGEITTICLKSIQVGSQPNNA
Immunogen RTLVPETARSGEMLVLDTDVFLYLKHKCGSYESTLKKFHILSQEKVDGEITTICLKSIQVGSQPNNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf38, FLJ45645
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZSC3
HTS Code 3002150000
Gene ID 375287
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBM43 Antibody 25ul

Anti-RBM43 Antibody 25ul