RASSF8,C12orf2,HoJ-1
  • RASSF8,C12orf2,HoJ-1

Anti-RASSF8 Antibody 25ul

Ref: AN-HPA038164-25ul
Anti-RASSF8

Información del producto

Polyclonal Antibody against Human RASSF8, Gene description: Ras association (RalGDS/AF-6) domain family (N-terminal) member 8, Alternative Gene Names: C12orf2, HoJ-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NHQ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RASSF8
Gene Description Ras association (RalGDS/AF-6) domain family (N-terminal) member 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQREVQEAQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQE
Immunogen KQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQREVQEAQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12orf2, HoJ-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NHQ8
HTS Code 3002150000
Gene ID 11228
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RASSF8 Antibody 25ul

Anti-RASSF8 Antibody 25ul