SH3BP5L,KIAA1720
  • SH3BP5L,KIAA1720

Anti-SH3BP5L Antibody 25ul

Ref: AN-HPA038068-25ul
Anti-SH3BP5L

Información del producto

Polyclonal Antibody against Human SH3BP5L, Gene description: SH3-binding domain protein 5-like, Alternative Gene Names: KIAA1720, Validated applications: ICC, IHC, WB, Uniprot ID: Q7L8J4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SH3BP5L
Gene Description SH3-binding domain protein 5-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence CQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPED
Immunogen CQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1720
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L8J4
HTS Code 3002150000
Gene ID 80851
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SH3BP5L Antibody 25ul

Anti-SH3BP5L Antibody 25ul