BCCIP,BCCIPalpha
  • BCCIP,BCCIPalpha

Anti-BCCIP Antibody 25ul

Ref: AN-HPA038011-25ul
Anti-BCCIP

Información del producto

Polyclonal Antibody against Human BCCIP, Gene description: BRCA2 and CDKN1A interacting protein, Alternative Gene Names: BCCIPalpha, TOK-1, Validated applications: ICC, Uniprot ID: Q9P287, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BCCIP
Gene Description BRCA2 and CDKN1A interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEEQGKPEVLGGPDTRRGLEPVPIQHNGGSR
Immunogen ALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEEQGKPEVLGGPDTRRGLEPVPIQHNGGSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCCIPalpha, TOK-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P287
HTS Code 3002150000
Gene ID 56647
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BCCIP Antibody 25ul

Anti-BCCIP Antibody 25ul