RAPGEF6,PDZ-GEF2
  • RAPGEF6,PDZ-GEF2

Anti-RAPGEF6 Antibody 25ul

Ref: AN-HPA037982-25ul
Anti-RAPGEF6

Información del producto

Polyclonal Antibody against Human RAPGEF6, Gene description: Rap guanine nucleotide exchange factor (GEF) 6, Alternative Gene Names: PDZ-GEF2, PDZGEF2, RA-GEF-2, Validated applications: IHC, Uniprot ID: Q8TEU7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAPGEF6
Gene Description Rap guanine nucleotide exchange factor (GEF) 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHSQHGPGWTLLKPSLIKCLAVSSSVSNEEISQEHIIIEAADS
Immunogen SNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHSQHGPGWTLLKPSLIKCLAVSSSVSNEEISQEHIIIEAADS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PDZ-GEF2, PDZGEF2, RA-GEF-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TEU7
HTS Code 3002150000
Gene ID 51735
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAPGEF6 Antibody 25ul

Anti-RAPGEF6 Antibody 25ul