C10orf53
  • C10orf53

Anti-C10orf53 Antibody 100ul

Ref: AN-HPA037951-100ul
Anti-C10orf53

Información del producto

Polyclonal Antibody against Human C10orf53, Gene description: chromosome 10 open reading frame 53, Alternative Gene Names: Em:AC069546.1, Validated applications: IHC, WB, Uniprot ID: Q8N6V4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C10orf53
Gene Description chromosome 10 open reading frame 53
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEF
Immunogen MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Em:AC069546.1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N6V4
HTS Code 3002150000
Gene ID 282966
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C10orf53 Antibody 100ul

Anti-C10orf53 Antibody 100ul