TNKS1BP1,FLJ45975
  • TNKS1BP1,FLJ45975

Anti-TNKS1BP1 Antibody 100ul

Ref: AN-HPA037929-100ul
Anti-TNKS1BP1

Información del producto

Polyclonal Antibody against Human TNKS1BP1, Gene description: tankyrase 1 binding protein 1, 182kDa, Alternative Gene Names: FLJ45975, KIAA1741, TAB182, Validated applications: IHC, Uniprot ID: Q9C0C2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNKS1BP1
Gene Description tankyrase 1 binding protein 1, 182kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEARE
Immunogen DWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEARE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ45975, KIAA1741, TAB182
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0C2
HTS Code 3002150000
Gene ID 85456
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNKS1BP1 Antibody 100ul

Anti-TNKS1BP1 Antibody 100ul