ARMC3,CT81,FLJ32827
  • ARMC3,CT81,FLJ32827

Anti-ARMC3 Antibody 25ul

Ref: AN-HPA037823-25ul
Anti-ARMC3

Información del producto

Polyclonal Antibody against Human ARMC3, Gene description: armadillo repeat containing 3, Alternative Gene Names: CT81, FLJ32827, Validated applications: IHC, Uniprot ID: Q5W041, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARMC3
Gene Description armadillo repeat containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR
Immunogen LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT81, FLJ32827
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5W041
HTS Code 3002150000
Gene ID 219681
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARMC3 Antibody 25ul

Anti-ARMC3 Antibody 25ul