ZNF487,KRBO1,ZNF487P
  • ZNF487,KRBO1,ZNF487P

Anti-ZNF487 Antibody 25ul

Ref: AN-HPA037820-25ul
Anti-ZNF487

Información del producto

Polyclonal Antibody against Human ZNF487, Gene description: zinc finger protein 487, Alternative Gene Names: KRBO1, ZNF487P, Validated applications: ICC, Uniprot ID: B1APH4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF487
Gene Description zinc finger protein 487
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EVVCKLEHGQVLWILEEESPSQSHLDCCIDDDLMEKRQENQDQHLQKVDFVNNKTLTMDRNGVLGKTFSLDTNPILSRKIRGNCDSSG
Immunogen EVVCKLEHGQVLWILEEESPSQSHLDCCIDDDLMEKRQENQDQHLQKVDFVNNKTLTMDRNGVLGKTFSLDTNPILSRKIRGNCDSSG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KRBO1, ZNF487P
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID B1APH4
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF487 Antibody 25ul

Anti-ZNF487 Antibody 25ul