VWA5A,BCSC-1
  • VWA5A,BCSC-1

Anti-VWA5A Antibody 100ul

Ref: AN-HPA037814-100ul
Anti-VWA5A

Información del producto

Polyclonal Antibody against Human VWA5A, Gene description: von Willebrand factor A domain containing 5A, Alternative Gene Names: BCSC-1, LOH11CR2A, Validated applications: ICC, IHC, Uniprot ID: O00534, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VWA5A
Gene Description von Willebrand factor A domain containing 5A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SLSWHLPPGLSAKMLSPEQTVIFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMGLRETPASDK
Immunogen SLSWHLPPGLSAKMLSPEQTVIFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMGLRETPASDK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCSC-1, LOH11CR2A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00534
HTS Code 3002150000
Gene ID 4013
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VWA5A Antibody 100ul

Anti-VWA5A Antibody 100ul