TTC23L,FLJ25439
  • TTC23L,FLJ25439

Anti-TTC23L Antibody 100ul

Ref: AN-HPA037807-100ul
Anti-TTC23L

Información del producto

Polyclonal Antibody against Human TTC23L, Gene description: tetratricopeptide repeat domain 23-like, Alternative Gene Names: FLJ25439, Validated applications: IHC, Uniprot ID: Q6PF05, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TTC23L
Gene Description tetratricopeptide repeat domain 23-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ASPIRIPTVSNDIDWDFCFRMSQQTEIPAHQQTDELYPTGGCGESEEETKAKEKEKAIDCMSHPKEKLAQSQKKVAQLIKEKMNTQANKELIR
Immunogen ASPIRIPTVSNDIDWDFCFRMSQQTEIPAHQQTDELYPTGGCGESEEETKAKEKEKAIDCMSHPKEKLAQSQKKVAQLIKEKMNTQANKELIR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ25439
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PF05
HTS Code 3002150000
Gene ID 153657
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTC23L Antibody 100ul

Anti-TTC23L Antibody 100ul