A1CF,ACF,ACF64
  • A1CF,ACF,ACF64

Anti-A1CF Antibody 25ul

Ref: AN-HPA037779-25ul
Anti-A1CF

Información del producto

Polyclonal Antibody against Human A1CF, Gene description: APOBEC1 complementation factor, Alternative Gene Names: ACF, ACF64, ACF65, APOBEC1CF, ASP, Validated applications: IHC, WB, Uniprot ID: Q9NQ94, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name A1CF
Gene Description APOBEC1 complementation factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA
Immunogen GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACF, ACF64, ACF65, APOBEC1CF, ASP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQ94
HTS Code 3002150000
Gene ID 29974
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-A1CF Antibody 25ul

Anti-A1CF Antibody 25ul