TRAPPC13,C5orf44
  • TRAPPC13,C5orf44

Anti-TRAPPC13 Antibody 100ul

Ref: AN-HPA037777-100ul
Anti-TRAPPC13

Información del producto

Polyclonal Antibody against Human TRAPPC13, Gene description: trafficking protein particle complex 13, Alternative Gene Names: C5orf44, FLJ13611, FLJ26957, MGC48585, Validated applications: ICC, IHC, WB, Uniprot ID: A5PLN9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TRAPPC13
Gene Description trafficking protein particle complex 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSY
Immunogen LGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C5orf44, FLJ13611, FLJ26957, MGC48585
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A5PLN9
HTS Code 3002150000
Gene ID 80006
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TRAPPC13 Antibody 100ul

Anti-TRAPPC13 Antibody 100ul