DNAH5,CILD3,Dnahc5
  • DNAH5,CILD3,Dnahc5

Anti-DNAH5 Antibody 25ul

Ref: AN-HPA037470-25ul
Anti-DNAH5

Información del producto

Polyclonal Antibody against Human DNAH5, Gene description: dynein, axonemal, heavy chain 5, Alternative Gene Names: CILD3, Dnahc5, HL1, KTGNR, PCD, Validated applications: IHC, Uniprot ID: Q8TE73, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAH5
Gene Description dynein, axonemal, heavy chain 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
Immunogen EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CILD3, Dnahc5, HL1, KTGNR, PCD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TE73
HTS Code 3002150000
Gene ID 1767
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAH5 Antibody 25ul

Anti-DNAH5 Antibody 25ul