DDX50,GU2,GUB
  • DDX50,GU2,GUB

Anti-DDX50 Antibody 100ul

Ref: AN-HPA037389-100ul
Anti-DDX50

Información del producto

Polyclonal Antibody against Human DDX50, Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 50, Alternative Gene Names: GU2, GUB, MGC3199, RH-II/GuB, Validated applications: ICC, WB, Uniprot ID: Q9BQ39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DDX50
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
Immunogen MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GU2, GUB, MGC3199, RH-II/GuB
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQ39
HTS Code 3002150000
Gene ID 79009
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DDX50 Antibody 100ul

Anti-DDX50 Antibody 100ul