WDR37,KIAA0982
  • WDR37,KIAA0982

Anti-WDR37 Antibody 100ul

Ref: AN-HPA037376-100ul
Anti-WDR37

Información del producto

Polyclonal Antibody against Human WDR37, Gene description: WD repeat domain 37, Alternative Gene Names: KIAA0982, Validated applications: IHC, WB, Uniprot ID: Q9Y2I8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WDR37
Gene Description WD repeat domain 37
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence FRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMSGVRLARLPRSSRQGHRRMVCCS
Immunogen FRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMSGVRLARLPRSSRQGHRRMVCCS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0982
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2I8
HTS Code 3002150000
Gene ID 22884
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR37 Antibody 100ul

Anti-WDR37 Antibody 100ul