TTC29,NYD-SP14
  • TTC29,NYD-SP14

Anti-TTC29 Antibody 25ul

Ref: AN-HPA037006-25ul
Anti-TTC29

Información del producto

Polyclonal Antibody against Human TTC29, Gene description: tetratricopeptide repeat domain 29, Alternative Gene Names: NYD-SP14, Validated applications: IHC, Uniprot ID: Q8NA56, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TTC29
Gene Description tetratricopeptide repeat domain 29
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLENKEYKQAIKILIKA
Immunogen IDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLENKEYKQAIKILIKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NYD-SP14
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NA56
HTS Code 3002150000
Gene ID 83894
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTC29 Antibody 25ul

Anti-TTC29 Antibody 25ul