RAI14,DKFZp564G013
  • RAI14,DKFZp564G013

Anti-RAI14 Antibody 100ul

Ref: AN-HPA036950-100ul
Anti-RAI14

Información del producto

Polyclonal Antibody against Human RAI14, Gene description: retinoic acid induced 14, Alternative Gene Names: DKFZp564G013, KIAA1334, NORPEG, RAI13, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P0K7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAI14
Gene Description retinoic acid induced 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRYAE
Immunogen KAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRYAE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp564G013, KIAA1334, NORPEG, RAI13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0K7
HTS Code 3002150000
Gene ID 26064
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAI14 Antibody 100ul

Anti-RAI14 Antibody 100ul